PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G35430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 351aa    MW: 38226.8 Da    PI: 6.3462
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G35430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-092632972155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      k +yps+ e+  LA+ +gL+++q+ +WF N+R ++
  OGLUM03G35430.1 263 KWPYPSEMEKMTLAQTTGLDQKQINNWFINQRKRH 297
                      669*****************************885 PP

2ELK37.64.8e-13217238122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      +LKhqLlrKY+g+Lg+L+q Fs
  OGLUM03G35430.1 217 QLKHQLLRKYGGSLGDLRQVFS 238
                      59*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.6E-1881125IPR005540KNOX1
PfamPF037903.0E-1882121IPR005540KNOX1
SMARTSM012561.4E-25136188IPR005541KNOX2
PfamPF037911.1E-19146186IPR005541KNOX2
PfamPF037892.9E-8217235IPR005539ELK domain
SMARTSM011882.3E-5217238IPR005539ELK domain
PROSITE profilePS512139.324217237IPR005539ELK domain
PROSITE profilePS5007112.503237300IPR001356Homeobox domain
SuperFamilySSF466892.22E-18239304IPR009057Homeodomain-like
SMARTSM003891.2E-11239304IPR001356Homeobox domain
CDDcd000861.01E-13240300No hitNo description
Gene3DG3DSA:1.10.10.609.8E-27242300IPR009057Homeodomain-like
PfamPF059207.0E-17257296IPR008422Homeobox KN domain
PROSITE patternPS000270275298IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MESFASLAGG GSSSTTARLP ELISPENPDH ISPPPLLYQL LAGPESSARQ HGHDGHHHGG  60
GGGAAAAAAV QGQVSPAGAE AAVKAEIMSH PEYSALLAAY LGCKKVGAPP DVLTKLTAVP  120
AAQQLDEADG HPRRRHEPQR DDDPDQLDQF MDAYCSMLTR YREELERPIQ EAAEFFSRVE  180
TQLDSLADSN CEGTGSSEEE QDTSCPEAEE IDPSDKQLKH QLLRKYGGSL GDLRQVFSKR  240
TKKGKLPKEA RQKLLHWWEL HYKWPYPSEM EKMTLAQTTG LDQKQINNWF INQRKRHWKP  300
TPVAGTAFPT MEAAGGGFRH SGHGGGLAAA AALPLYMGKP FVVDGMYRLG S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00671PBMTransfer from GRMZM2G135447Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0288840.0AB028884.1 Oryza sativa mRNA for knotted1-type homeobox protein OSH43, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628321.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
RefseqXP_015628323.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
RefseqXP_015628324.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
RefseqXP_015628325.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
SwissprotQ10ED20.0KNOS8_ORYSJ; Homeobox protein knotted-1-like 8
TrEMBLA0A0D9ZDR00.0A0A0D9ZDR0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013637-PA0.0(Oryza sativa Indica Group)
STRINGORGLA03G0327100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147561321
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-72KNOTTED-like from Arabidopsis thaliana